Nkx3.1 (NKX3-1) (NM_006167) Human Recombinant Protein

SKU
TP310374
Recombinant protein of human NK3 homeobox 1 (NKX3-1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210374 protein sequence
Red=Cloning site Green=Tags(s)

MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAG
AQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELE
RKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASL
VSVYNSYPYYPYLYCVGSWSPAFW

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006158
Locus ID 4824
UniProt ID Q99801
Cytogenetics 8p21.2
RefSeq Size 3281
RefSeq ORF 702
Synonyms BAPX2; NKX3; NKX3.1; NKX3A
Summary This gene encodes a homeobox-containing transcription factor. This transcription factor functions as a negative regulator of epithelial cell growth in prostate tissue. Aberrant expression of this gene is associated with prostate tumor progression. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jan 2012]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Pathways in cancer, Prostate cancer
Write Your Own Review
You're reviewing:Nkx3.1 (NKX3-1) (NM_006167) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310374 NKX3 MS Standard C13 and N15-labeled recombinant protein (NP_006158) 10 ug
$3,255.00
LC401858 NKX3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401858 Transient overexpression lysate of NK3 homeobox 1 (NKX3-1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.