Nkx3.1 (NKX3-1) (NM_006167) Human Mass Spec Standard

SKU
PH310374
NKX3 MS Standard C13 and N15-labeled recombinant protein (NP_006158)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210374]
Predicted MW 26.4 kDa
Protein Sequence
Protein Sequence
>RC210374 protein sequence
Red=Cloning site Green=Tags(s)

MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAG
AQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELE
RKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASL
VSVYNSYPYYPYLYCVGSWSPAFW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006158
RefSeq Size 3281
RefSeq ORF 702
Synonyms BAPX2; NKX3; NKX3.1; NKX3A
Locus ID 4824
UniProt ID Q99801
Cytogenetics 8p21.2
Summary This gene encodes a homeobox-containing transcription factor. This transcription factor functions as a negative regulator of epithelial cell growth in prostate tissue. Aberrant expression of this gene is associated with prostate tumor progression. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jan 2012]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Pathways in cancer, Prostate cancer
Write Your Own Review
You're reviewing:Nkx3.1 (NKX3-1) (NM_006167) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401858 NKX3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401858 Transient overexpression lysate of NK3 homeobox 1 (NKX3-1) 100 ug
$436.00
TP310374 Recombinant protein of human NK3 homeobox 1 (NKX3-1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.