NPTN (NM_017455) Human Recombinant Protein

SKU
TP310326
Recombinant protein of human neuroplastin (NPTN), transcript variant alpha, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210326 protein sequence
Red=Cloning site Green=Tags(s)

MSGSSLPSALALSLLLVSGSLLPGPGAAQNEPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTK
NGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDAT
MYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSAS
VVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRN
TN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 28.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_059429
Locus ID 27020
UniProt ID Q9Y639
Cytogenetics 15q24.1
RefSeq Size 2106
RefSeq ORF 846
Synonyms GP55; GP65; np55; np65; SDFR1; SDR1
Summary This gene encodes a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2009]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:NPTN (NM_017455) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310326 NPTN MS Standard C13 and N15-labeled recombinant protein (NP_059429) 10 ug
$3,255.00
LC413759 NPTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431237 NPTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431345 NPTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413759 Transient overexpression lysate of neuroplastin (NPTN), transcript variant a 100 ug
$436.00
LY431237 Transient overexpression lysate of neuroplastin (NPTN), transcript variant d 100 ug
$436.00
LY431345 Transient overexpression lysate of neuroplastin (NPTN), transcript variant c 100 ug
$436.00
TP720412 Recombinant protein of human neuroplastin (NPTN), transcript variant c. 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.