NPTN (NM_017455) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC210326] |
Predicted MW | 31.3 kDa |
Protein Sequence |
Protein Sequence
>RC210326 protein sequence
Red=Cloning site Green=Tags(s) MSGSSLPSALALSLLLVSGSLLPGPGAAQNEPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTK NGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDAT MYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSAS VVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRN TN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_059429 |
RefSeq Size | 2106 |
RefSeq ORF | 846 |
Synonyms | GP55; GP65; np55; np65; SDFR1; SDR1 |
Locus ID | 27020 |
UniProt ID | Q9Y639 |
Cytogenetics | 15q24.1 |
Summary | This gene encodes a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2009] |
Protein Families | Druggable Genome, Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC413759 | NPTN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431237 | NPTN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431345 | NPTN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY413759 | Transient overexpression lysate of neuroplastin (NPTN), transcript variant a | 100 ug |
$436.00
|
|
LY431237 | Transient overexpression lysate of neuroplastin (NPTN), transcript variant d | 100 ug |
$436.00
|
|
LY431345 | Transient overexpression lysate of neuroplastin (NPTN), transcript variant c | 100 ug |
$436.00
|
|
TP310326 | Recombinant protein of human neuroplastin (NPTN), transcript variant alpha, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720412 | Recombinant protein of human neuroplastin (NPTN), transcript variant c. | 10 ug |
$265.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.