NPTN (NM_017455) Human Mass Spec Standard

SKU
PH310326
NPTN MS Standard C13 and N15-labeled recombinant protein (NP_059429)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210326]
Predicted MW 31.3 kDa
Protein Sequence
Protein Sequence
>RC210326 protein sequence
Red=Cloning site Green=Tags(s)

MSGSSLPSALALSLLLVSGSLLPGPGAAQNEPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTK
NGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDAT
MYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSAS
VVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRN
TN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_059429
RefSeq Size 2106
RefSeq ORF 846
Synonyms GP55; GP65; np55; np65; SDFR1; SDR1
Locus ID 27020
UniProt ID Q9Y639
Cytogenetics 15q24.1
Summary This gene encodes a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2009]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:NPTN (NM_017455) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413759 NPTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431237 NPTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431345 NPTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413759 Transient overexpression lysate of neuroplastin (NPTN), transcript variant a 100 ug
$436.00
LY431237 Transient overexpression lysate of neuroplastin (NPTN), transcript variant d 100 ug
$436.00
LY431345 Transient overexpression lysate of neuroplastin (NPTN), transcript variant c 100 ug
$436.00
TP310326 Recombinant protein of human neuroplastin (NPTN), transcript variant alpha, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720412 Recombinant protein of human neuroplastin (NPTN), transcript variant c. 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.