Macrophage Inflammatory Protein 4 (CCL18) (NM_002988) Human Recombinant Protein
SKU
TP310245
Recombinant protein of human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), 20 µg
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC210245 protein sequence
Red=Cloning site Green=Tags(s) MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQIC ADPNKKWVQKYISDLKLNA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002979 |
Locus ID | 6362 |
UniProt ID | P55774 |
Cytogenetics | 17q12 |
RefSeq Size | 798 |
RefSeq ORF | 267 |
Synonyms | AMAC-1; AMAC1; CKb7; DC-CK1; DCCK1; MIP-4; PARC; SCYA18 |
Summary | This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for naive T cells, CD4+ and CD8+ T cells and nonactivated lymphocytes, but not for monocytes or granulocytes. This chemokine attracts naive T lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It may play a role in both humoral and cell-mediated immunity responses. [provided by RefSeq, Sep 2014] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH310245 | CCL18 MS Standard C13 and N15-labeled recombinant protein (NP_002979) | 10 ug |
$3,255.00
|
|
LC418972 | CCL18 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY418972 | Transient overexpression lysate of chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18) | 100 ug |
$436.00
|
|
TP720895 | Purified recombinant protein of Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18) | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.