Gastrin (GAST) (NM_000805) Human Recombinant Protein

SKU
TP310222
Recombinant protein of human gastrin (GAST), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210222 protein sequence
Red=Cloning site Green=Tags(s)

MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVA
DPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 9.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000796
Locus ID 2520
UniProt ID P01350
Cytogenetics 17q21.2
RefSeq Size 475
RefSeq ORF 303
Synonyms GAS
Summary Gastrin is a hormone whose main function is to stimulate secretion of hydrochloric acid by the gastric mucosa, which results in gastrin formation inhibition. This hormone also acts as a mitogenic factor for gastrointestinal epithelial cells. Gastrin has two biologically active peptide forms, G34 and G17. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:Gastrin (GAST) (NM_000805) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310222 GAST MS Standard C13 and N15-labeled recombinant protein (NP_000796) 10 ug
$3,255.00
LC424512 GAST HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424512 Transient overexpression lysate of gastrin (GAST) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.