Gastrin (GAST) (NM_000805) Human Mass Spec Standard

SKU PH310222

GAST MS Standard C13 and N15-labeled recombinant protein (NP_000796)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC210222]
• Predicted MW: 11.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC210222 protein sequence; Red=Cloning site Green=Tags(s); ; MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVA; DPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_000796
• RefSeq Size: 475
• RefSeq ORF: 303
• Synonyms: GAS
• Locus ID: 2520
• UniProt ID: P01350
• Cytogenetics: 17q21.2
• Summary: Gastrin is a hormone whose main function is to stimulate secretion of hydrochloric acid by the gastric mucosa, which results in gastrin formation inhibition. This hormone also acts as a mitogenic factor for gastrointestinal epithelial cells. Gastrin has two biologically active peptide forms, G34 and G17. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein