SPARC (NM_003118) Human Recombinant Protein

SKU
TP309964
Recombinant protein of human secreted protein, acidic, cysteine-rich (osteonectin) (SPARC), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209964 protein sequence
Red=Cloning site Green=Tags(s)

MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAEN
PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHK
LHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGD
HPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKY
IALDEWAGCFGIKQKDIDKDLVI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003109
Locus ID 6678
UniProt ID P09486
Cytogenetics 5q33.1
RefSeq Size 3604
RefSeq ORF 909
Synonyms BM-40; OI17; ON; ONT
Summary This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2015]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:SPARC (NM_003118) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309964 SPARC MS Standard C13 and N15-labeled recombinant protein (NP_003109) 10 ug
$3,255.00
LC418873 SPARC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418873 Transient overexpression lysate of secreted protein, acidic, cysteine-rich (osteonectin) (SPARC) 100 ug
$436.00
TP720332 Recombinant protein of human secreted protein, acidic, cysteine-rich (osteonectin) (SPARC) 10 ug
$185.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.