SPARC (NM_003118) Human Mass Spec Standard

SKU
PH309964
SPARC MS Standard C13 and N15-labeled recombinant protein (NP_003109)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209964]
Predicted MW 34.6 kDa
Protein Sequence
Protein Sequence
>RC209964 protein sequence
Red=Cloning site Green=Tags(s)

MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAEN
PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHK
LHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGD
HPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKY
IALDEWAGCFGIKQKDIDKDLVI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003109
RefSeq Size 3604
RefSeq ORF 909
Synonyms BM-40; OI17; ON; ONT
Locus ID 6678
UniProt ID P09486
Cytogenetics 5q33.1
Summary This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2015]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:SPARC (NM_003118) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418873 SPARC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418873 Transient overexpression lysate of secreted protein, acidic, cysteine-rich (osteonectin) (SPARC) 100 ug
$436.00
TP309964 Recombinant protein of human secreted protein, acidic, cysteine-rich (osteonectin) (SPARC), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720332 Recombinant protein of human secreted protein, acidic, cysteine-rich (osteonectin) (SPARC) 10 ug
$185.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.