RHOB (NM_004040) Human Recombinant Protein

SKU
TP309837
Recombinant protein of human ras homolog gene family, member B (RHOB), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209837 protein sequence
Red=Cloning site Green=Tags(s)

MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR
PLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVR
TDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004031
Locus ID 388
UniProt ID P62745
Cytogenetics 2p24.1
RefSeq Size 2384
RefSeq ORF 588
Synonyms ARH6; ARHB; MST081; MSTP081; RHOH6
Summary Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RHOB (NM_004040) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309837 RHOB MS Standard C13 and N15-labeled recombinant protein (NP_004031) 10 ug
$3,255.00
LC418297 RHOB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418297 Transient overexpression lysate of ras homolog gene family, member B (RHOB) 100 ug
$436.00
TP701009 Purified recombinant protein of Human ras homolog gene family, member B (RHOB), mutant (S73F), expressed in HEK293 cells, 20ug 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.