OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RHOB (NM_004040) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP309837
Recombinant protein of human ras homolog gene family, member B (RHOB), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA322808 Anti-RHOB Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "RHOB or NM_004040"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209837 protein sequence
Red=Cloning site Green=Tags(s)

MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR
PLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVR
TDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004031
Locus ID 388
UniProt ID P62745
Cytogenetics 2p24.1
RefSeq Size 2384
RefSeq ORF 588
Synonyms ARH6; ARHB; MST081; MSTP081; RHOH6
Summary Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells.UniProtKB/Swiss-Prot Function
Protein Categories Cytokines, Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RHOB" proteins (4)
SKU Description Size Price
PH309837 RHOB MS Standard C13 and N15-labeled recombinant protein (NP_004031) 10 ug
$3,360.00
LC418297 Lyophilized RHOB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418297 Transient overexpression lysate of ras homolog gene family, member B (RHOB) (as WB positive control) 100 ug
$436.00
TP701009 Purified recombinant protein of Human ras homolog gene family, member B (RHOB), mutant (S73F), expressed in HEK293 cells, 20ug 20 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products