OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RHOB (NM_004040) Human Mass Spec Standard

Be the first to review this product
SKU
PH309837
RHOB MS Standard C13 and N15-labeled recombinant protein (NP_004031)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322808 Anti-RHOB Rabbit Polyclonal Antibody
100 ul
$305.00
LY418297 Transient overexpression lysate of ras homolog gene family, member B (RHOB) (as WB positive control) 100 ug
$436.00

Other products for "RHOB or NM_004040"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209837
Predicted MW 22.1 kDa
Protein Sequence
Protein Sequence
>RC209837 protein sequence
Red=Cloning site Green=Tags(s)

MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR
PLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVR
TDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004031
RefSeq Size 2384
RefSeq ORF 588
Synonyms ARH6; ARHB; MST081; MSTP081; RHOH6
Locus ID 388
UniProt ID P62745
Cytogenetics 2p24.1
Summary Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RHOB" proteins (4)
SKU Description Size Price
LC418297 Lyophilized RHOB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418297 Transient overexpression lysate of ras homolog gene family, member B (RHOB) (as WB positive control) 100 ug
$436.00
TP309837 Recombinant protein of human ras homolog gene family, member B (RHOB), 20 µg 20 ug
$867.00
TP701009 Purified recombinant protein of Human ras homolog gene family, member B (RHOB), mutant (S73F), expressed in HEK293 cells, 20ug 20 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products