ENSA (NM_207168) Human Recombinant Protein

SKU
TP309655
Recombinant protein of human endosulfine alpha (ENSA), transcript variant 8, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209655 protein sequence
Red=Cloning site Green=Tags(s)

MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGVWGIVSYPL
SLELKEVLRMKSVEVLLDPFLEVLLLNRSRGEFEI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_997051
Locus ID 2029
UniProt ID O43768
Cytogenetics 1q21.3
RefSeq Size 771
RefSeq ORF 315
Synonyms ARPP-19e
Summary The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:ENSA (NM_207168) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309655 ENSA MS Standard C13 and N15-labeled recombinant protein (NP_997051) 10 ug
$3,255.00
PH320441 ENSA MS Standard C13 and N15-labeled recombinant protein (NP_996925) 10 ug
$3,255.00
LC404060 ENSA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404105 ENSA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417988 ENSA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404060 Transient overexpression lysate of endosulfine alpha (ENSA), transcript variant 8 100 ug
$436.00
LY404105 Transient overexpression lysate of endosulfine alpha (ENSA), transcript variant 1 100 ug
$436.00
LY417988 Transient overexpression lysate of endosulfine alpha (ENSA), transcript variant 3 100 ug
$436.00
TP320441 Recombinant protein of human endosulfine alpha (ENSA), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.