ENSA (NM_207042) Human Mass Spec Standard

SKU
PH320441
ENSA MS Standard C13 and N15-labeled recombinant protein (NP_996925)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220441]
Predicted MW 15.1 kDa
Protein Sequence
Protein Sequence
>RC220441 representing NM_207042
Red=Cloning site Green=Tags(s)

MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGDYKSLHWSV
LLCADEMQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_996925
RefSeq Size 1300
RefSeq ORF 411
Synonyms ARPP-19e
Locus ID 2029
UniProt ID O43768
Cytogenetics 1q21.3
Summary The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:ENSA (NM_207042) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309655 ENSA MS Standard C13 and N15-labeled recombinant protein (NP_997051) 10 ug
$3,255.00
LC404060 ENSA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404105 ENSA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417988 ENSA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404060 Transient overexpression lysate of endosulfine alpha (ENSA), transcript variant 8 100 ug
$436.00
LY404105 Transient overexpression lysate of endosulfine alpha (ENSA), transcript variant 1 100 ug
$436.00
LY417988 Transient overexpression lysate of endosulfine alpha (ENSA), transcript variant 3 100 ug
$436.00
TP309655 Recombinant protein of human endosulfine alpha (ENSA), transcript variant 8, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320441 Recombinant protein of human endosulfine alpha (ENSA), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.