FAM13C1 (FAM13C) (NM_001001971) Human Recombinant Protein

SKU
TP309580
Recombinant protein of human family with sequence similarity 13, member C (FAM13C), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209580 protein sequence
Red=Cloning site Green=Tags(s)

MFSCFCFSLQDNSFSSTTVTECDEDPVSLHEDQTDCSSLRDENNKENYPDAGALVEEHAPPSWEPQQQNV
EATVLVDSVLRPSMGNFKSRKPKSIFKAESGRSHGESQETEHVVSSQSECQVRAGTPAHESPQNNAFKCQ
ETVRLQPRIDQRTAISPKDAFETRQDLNEEEAAQVHGVKDPAPASTQSVLADGTDSADPSPVHKDGQNEA
DSAPEDLHSVGTSRLLYHITDGDNPLLSPRCSIFSQSQRFNLDPESAPSPPSTQQFMMPRSSSRCSCGDG
KEPQTITQLTKHIQSLKRKIRKFEEKFEQEKKYRVTKQDKNLIKPLYDRYRIIKQILSTPSLIPTIQEEE
DSDEDRPQGSQQPSLADPASHLPVGDHLTYSNETEPVRALLPDEKKEVKPPALSMSNLHEATMPVLLDHL
RETRADKKRLRKALREFEEQFFKQTGRSPQKEDRIPMADEYYEYKHIKAKLRLLEVLISKQDVAKTI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001001971
Locus ID 220965
UniProt ID Q8NE31
Cytogenetics 10q21.1
RefSeq Size 3101
RefSeq ORF 1461
Synonyms FAM13C1
Write Your Own Review
You're reviewing:FAM13C1 (FAM13C) (NM_001001971) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309580 FAM13C MS Standard C13 and N15-labeled recombinant protein (NP_001001971) 10 ug
$3,255.00
LC404877 FAM13C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424301 FAM13C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404877 Transient overexpression lysate of family with sequence similarity 13, member C (FAM13C), transcript variant 1 100 ug
$436.00
LY424301 Transient overexpression lysate of family with sequence similarity 13, member C (FAM13C), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.