OriGene Logo

FAM13C1 (FAM13C) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA336196
Rabbit Polyclonal Anti-FAM13C1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY404877 Transient overexpression lysate of family with sequence similarity 13, member C (FAM13C), transcript variant 1 100 ug
$436.00
TP309580 Recombinant protein of human family with sequence similarity 13, member C (FAM13C), transcript variant 2, 20 µg
20 ug
$867.00

View other "FAM13C1 or NM_001001971" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-FAM13C1 Antibody: synthetic peptide directed towards the N terminal of human FAM13C1. Synthetic peptide located within the following region: TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 55 kDa
Gene Name family with sequence similarity 13 member C
Database Link
Background FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.
Synonyms FAM13C1
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 92%; Rat: 92%; Pig: 85%; Guinea pig: 85%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.