FAM13C1 (FAM13C) Rabbit Polyclonal Antibody

SKU TA336196

Rabbit Polyclonal Anti-FAM13C1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM13C1 Antibody: synthetic peptide directed towards the N terminal of human FAM13C1. Synthetic peptide located within the following region: TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: family with sequence similarity 13 member C
• Database Link:
  NP_001001971
  Q8NE31
• Background: FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.
• Synonyms: FAM13C1
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 92%; Rat: 92%; Pig: 85%; Guinea pig: 85%

Reference Data