COQ9 (NM_020312) Human Recombinant Protein

SKU
TP309578
Recombinant protein of human coenzyme Q9 homolog (S. cerevisiae) (COQ9), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209578 protein sequence
Red=Cloning site Green=Tags(s)

MAAAAVSGALGRAGWRLLQLRCLPVARCRQALVPRAFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEK
PDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGK
DGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLP
HNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDA
MNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_064708
Locus ID 57017
UniProt ID O75208
Cytogenetics 16q21
RefSeq Size 1699
RefSeq ORF 954
Synonyms C16orf49; COQ10D5
Summary This locus represents a mitochondrial ubiquinone biosynthesis gene. The encoded protein is likely necessary for biosynthesis of coenzyme Q10, as mutations at this locus have been associated with autosomal-recessive neonatal-onset primary coenzyme Q10 deficiency.[provided by RefSeq, Sep 2010]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:COQ9 (NM_020312) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309578 COQ9 MS Standard C13 and N15-labeled recombinant protein (NP_064708) 10 ug
$3,255.00
LC412553 COQ9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412553 Transient overexpression lysate of coenzyme Q9 homolog (S. cerevisiae) (COQ9) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.