COQ9 (NM_020312) Human Mass Spec Standard

SKU
PH309578
COQ9 MS Standard C13 and N15-labeled recombinant protein (NP_064708)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209578]
Predicted MW 35.5 kDa
Protein Sequence
Protein Sequence
>RC209578 protein sequence
Red=Cloning site Green=Tags(s)

MAAAAVSGALGRAGWRLLQLRCLPVARCRQALVPRAFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEK
PDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGK
DGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLP
HNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDA
MNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064708
RefSeq Size 1699
RefSeq ORF 954
Synonyms C16orf49; COQ10D5
Locus ID 57017
UniProt ID O75208
Cytogenetics 16q21
Summary This locus represents a mitochondrial ubiquinone biosynthesis gene. The encoded protein is likely necessary for biosynthesis of coenzyme Q10, as mutations at this locus have been associated with autosomal-recessive neonatal-onset primary coenzyme Q10 deficiency.[provided by RefSeq, Sep 2010]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:COQ9 (NM_020312) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412553 COQ9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412553 Transient overexpression lysate of coenzyme Q9 homolog (S. cerevisiae) (COQ9) 100 ug
$436.00
TP309578 Recombinant protein of human coenzyme Q9 homolog (S. cerevisiae) (COQ9), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.