LLGL2 (NM_001031803) Human Recombinant Protein

SKU
TP309559
Purified recombinant protein of Homo sapiens lethal giant larvae homolog 2 (Drosophila) (LLGL2), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209559 protein sequence
Red=Cloning site Green=Tags(s)

MRRFLRPGHDPVRERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLH
QENNAVTQIHLLPGQCQLVTLLDDNSLHLWSLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSS
CELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSR
GLVVIWDLQGSRVLYHFLSSQQLENIWWQRDGRLLVSCHSDGSYCQWPVSSEAQQPEPLRSLVPYGPFPC
KAITRILWLTTRQGLPFTIFQGGMPRASYGDRHCISVIHDGQQTAFDFTSRVIGFTVLTEADPAATFDDP
YALVVLAEEELVVIDLQTAGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQNAHFSTMEW
PIDGGTSLTPAPPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPNENLSAQGEDEWPPL
RKVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQDQEGYRWKG
HERLAARSGPVRFEPGFQPFVLVQCQPPAVVTSLALHSEWRLVAFGTSHGFGLFDHQQRRQVFVKCTLHP
SDQLALEGPLSRVKSLKKSLRQSFRRMRRSRVSSRKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKI
EARSAEDSFTGFVRTLYFADTYLKDSSRHCPSLWAGTNGGTIYAFSLRVPPAERRMDESVRAEQAKEIQL
MHRAPVVGILVLDGHSVPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEG
SRVRRVSVAHFGSRRAEDYGEHHLAVLTNLGDIQVVSLPLLKPQVRYSCIRREDVSGIASCVFTKYGQGF
YLISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARNSGTQSDGEEKQPGLVMERAL
LSDERVLKEIQSTLEGDRGSGNWRSHRAAVGCSLSNGGAE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 113.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001026973
Locus ID 3993
UniProt ID Q6P1M3
Cytogenetics 17q25.1
RefSeq Size 3590
RefSeq ORF 3060
Synonyms HGL; Hugl-2; LGL2
Summary The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the protein's ability to localize cell fate determinants is regulated by the atypical protein kinase C (aPKC). In human, this protein interacts with aPKC-containing complexes and is cortically localized in mitotic cells. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Tight junction
Write Your Own Review
You're reviewing:LLGL2 (NM_001031803) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309559 LLGL2 MS Standard C13 and N15-labeled recombinant protein (NP_001026973) 10 ug
$3,255.00
LC422194 LLGL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423111 LLGL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY422194 Transient overexpression lysate of lethal giant larvae homolog 2 (Drosophila) (LLGL2), transcript variant 3 100 ug
$436.00
LY423111 Transient overexpression lysate of lethal giant larvae homolog 2 (Drosophila) (LLGL2), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.