C3orf39 (POMGNT2) (NM_032806) Human Recombinant Protein

SKU
TP309307
Recombinant protein of human chromosome 3 open reading frame 39 (C3orf39), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209307 protein sequence
Red=Cloning site Green=Tags(s)

MHLSAVFNALLVSVLAAVLWKHVRLREHAATLEEELALSRQATEPAPALRIDYPKALQILMEGGTHMVCT
GRTHTDRICRFKWLCYSNEAEEFIFFHGNTSVMLPNLGSRRFQPALLDLSTVEDHNTQYFNFVELPAAAL
RFMPKPVFVPDVALIANRFNPDNLMHVFHDDLLPLFYTLRQFPGLAHEARLFFMEGWGEGAHFDLYKLLS
PKQPLLRAQLKTLGRLLCFSHAFVGLSKITTWYQYGFVQPQGPKANILVSGNEIRQFARFMTEKLNVSHT
GVPLGEEYILVFSRTQNRLILNEAELLLALAQEFQMKTVTVSLEDHTFADVVRLVSNASMLVSMHGAQLV
TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPENTVTHPERPWDQGGITHLDRA
EQARILQSREVPRHLCCRNPEWLFRIYQDTKVDIPSLIQTIRRVVKGRPGPRKQKWTVGLYPGKVREARC
QASVHGASEARLTVSWQIPWNLKYLKVREVKYEVWLQEQGENTYVPYILALQNHTFTENIKPFTTYLVWV
RCIFNKILLGPFADVLVCNT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 66.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_116195
Locus ID 84892
UniProt ID Q8NAT1
Cytogenetics 3p22.1
RefSeq Size 2556
RefSeq ORF 1740
Synonyms AGO61; C3orf39; GTDC2; MDDGA8; MDDGC8
Summary This gene encodes a protein with glycosyltransferase activity although its function is not currently known. [provided by RefSeq, Sep 2012]
Write Your Own Review
You're reviewing:C3orf39 (POMGNT2) (NM_032806) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309307 C3orf39 MS Standard C13 and N15-labeled recombinant protein (NP_116195) 10 ug
$3,255.00
LC409933 POMGNT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409933 Transient overexpression lysate of chromosome 3 open reading frame 39 (C3orf39) 100 ug
$436.00
TP762604 Purified recombinant protein of Human chromosome 3 open reading frame 39 (C3orf39), full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.