C3orf39 (POMGNT2) (NM_032806) Human Mass Spec Standard

SKU
PH309307
C3orf39 MS Standard C13 and N15-labeled recombinant protein (NP_116195)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209307]
Predicted MW 66.6 kDa
Protein Sequence
Protein Sequence
>RC209307 protein sequence
Red=Cloning site Green=Tags(s)

MHLSAVFNALLVSVLAAVLWKHVRLREHAATLEEELALSRQATEPAPALRIDYPKALQILMEGGTHMVCT
GRTHTDRICRFKWLCYSNEAEEFIFFHGNTSVMLPNLGSRRFQPALLDLSTVEDHNTQYFNFVELPAAAL
RFMPKPVFVPDVALIANRFNPDNLMHVFHDDLLPLFYTLRQFPGLAHEARLFFMEGWGEGAHFDLYKLLS
PKQPLLRAQLKTLGRLLCFSHAFVGLSKITTWYQYGFVQPQGPKANILVSGNEIRQFARFMTEKLNVSHT
GVPLGEEYILVFSRTQNRLILNEAELLLALAQEFQMKTVTVSLEDHTFADVVRLVSNASMLVSMHGAQLV
TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPENTVTHPERPWDQGGITHLDRA
EQARILQSREVPRHLCCRNPEWLFRIYQDTKVDIPSLIQTIRRVVKGRPGPRKQKWTVGLYPGKVREARC
QASVHGASEARLTVSWQIPWNLKYLKVREVKYEVWLQEQGENTYVPYILALQNHTFTENIKPFTTYLVWV
RCIFNKILLGPFADVLVCNT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116195
RefSeq Size 2556
RefSeq ORF 1740
Synonyms AGO61; C3orf39; GTDC2; MDDGA8; MDDGC8
Locus ID 84892
UniProt ID Q8NAT1
Cytogenetics 3p22.1
Summary This gene encodes a protein with glycosyltransferase activity although its function is not currently known. [provided by RefSeq, Sep 2012]
Write Your Own Review
You're reviewing:C3orf39 (POMGNT2) (NM_032806) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409933 POMGNT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409933 Transient overexpression lysate of chromosome 3 open reading frame 39 (C3orf39) 100 ug
$436.00
TP309307 Recombinant protein of human chromosome 3 open reading frame 39 (C3orf39), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP762604 Purified recombinant protein of Human chromosome 3 open reading frame 39 (C3orf39), full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.