CRMP2 (DPYSL2) (NM_001386) Human Recombinant Protein
CAT#: TP309080
Purified recombinant protein of Homo sapiens dihydropyrimidinase-like 2 (DPYSL2), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209080 protein sequence
Red=Cloning site Green=Tags(s) MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGI DVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVD ISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQ RILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPIT ASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTL IPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTI SAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAE LRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVA PPGGRANITSLG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 62.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | WB positive control (PMID: 29774780) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001377 |
Locus ID | 1808 |
UniProt ID | Q16555 |
Cytogenetics | 8p21.2 |
Refseq Size | 4638 |
Refseq ORF | 1716 |
Synonyms | CRMP-2; CRMP2; DHPRP2; DRP-2; DRP2; N2A3; ULIP-2; ULIP2 |
Summary | This gene encodes a member of the collapsin response mediator protein family. Collapsin response mediator proteins form homo- and hetero-tetramers and facilitate neuron guidance, growth and polarity. The encoded protein promotes microtubule assembly and is required for Sema3A-mediated growth cone collapse, and also plays a role in synaptic signaling through interactions with calcium channels. This gene has been implicated in multiple neurological disorders, and hyperphosphorylation of the encoded protein may play a key role in the development of Alzheimer's disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Axon guidance |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419992 | DPYSL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC434367 | DPYSL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY419992 | Transient overexpression lysate of dihydropyrimidinase-like 2 (DPYSL2) |
USD 436.00 |
|
LY434367 | Transient overexpression lysate of dihydropyrimidinase-like 2 (DPYSL2), transcript variant 1 |
USD 665.00 |
|
PH309080 | DPYSL2 MS Standard C13 and N15-labeled recombinant protein (NP_001377) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review