CRMP2 (DPYSL2) (NM_001386) Human Mass Spec Standard

SKU
PH309080
DPYSL2 MS Standard C13 and N15-labeled recombinant protein (NP_001377)
$3,255.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209080]
Predicted MW 62.3 kDa
Protein Sequence
Protein Sequence
>RC209080 protein sequence
Red=Cloning site Green=Tags(s)

MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGI
DVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVD
ISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQ
RILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPIT
ASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTL
IPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTI
SAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAE
LRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVA
PPGGRANITSLG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001377
RefSeq Size 4638
RefSeq ORF 1716
Synonyms CRMP-2; CRMP2; DHPRP2; DRP-2; DRP2; N2A3; ULIP-2; ULIP2
Locus ID 1808
UniProt ID Q16555
Cytogenetics 8p21.2
Summary This gene encodes a member of the collapsin response mediator protein family. Collapsin response mediator proteins form homo- and hetero-tetramers and facilitate neuron guidance, growth and polarity. The encoded protein promotes microtubule assembly and is required for Sema3A-mediated growth cone collapse, and also plays a role in synaptic signaling through interactions with calcium channels. This gene has been implicated in multiple neurological disorders, and hyperphosphorylation of the encoded protein may play a key role in the development of Alzheimer's disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011]
Protein Families Druggable Genome
Protein Pathways Axon guidance
Write Your Own Review
You're reviewing:CRMP2 (DPYSL2) (NM_001386) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419992 DPYSL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434367 DPYSL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419992 Transient overexpression lysate of dihydropyrimidinase-like 2 (DPYSL2) 100 ug
$436.00
LY434367 Transient overexpression lysate of dihydropyrimidinase-like 2 (DPYSL2), transcript variant 1 100 ug
$665.00
TP309080 Purified recombinant protein of Homo sapiens dihydropyrimidinase-like 2 (DPYSL2), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.