ORC6L (ORC6) (NM_014321) Human Recombinant Protein

SKU
TP309054
Recombinant protein of human origin recognition complex, subunit 6 like (yeast) (ORC6L), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209054 protein sequence
Red=Cloning site Green=Tags(s)

MGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIK
LSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKSYESSLPQTQQVDLDLSRPLF
TSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAK
EMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055136
Locus ID 23594
UniProt ID Q9Y5N6
Cytogenetics 16q11.2
RefSeq Size 1644
RefSeq ORF 756
Synonyms ORC6L
Summary The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. Gene silencing studies with small interfering RNA demonstrated that this protein plays an essential role in coordinating chromosome replication and segregation with cytokinesis. [provided by RefSeq, Oct 2010]
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Cell cycle
Write Your Own Review
You're reviewing:ORC6L (ORC6) (NM_014321) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309054 ORC6L MS Standard C13 and N15-labeled recombinant protein (NP_055136) 10 ug
$3,255.00
LC415362 ORC6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415362 Transient overexpression lysate of origin recognition complex, subunit 6 like (yeast) (ORC6L) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.