ORC6L (ORC6) (NM_014321) Human Mass Spec Standard

SKU
PH309054
ORC6L MS Standard C13 and N15-labeled recombinant protein (NP_055136)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209054]
Predicted MW 28.1 kDa
Protein Sequence
Protein Sequence
>RC209054 protein sequence
Red=Cloning site Green=Tags(s)

MGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIK
LSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKSYESSLPQTQQVDLDLSRPLF
TSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAK
EMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055136
RefSeq Size 1644
RefSeq ORF 756
Synonyms ORC6L
Locus ID 23594
UniProt ID Q9Y5N6
Cytogenetics 16q11.2
Summary The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. Gene silencing studies with small interfering RNA demonstrated that this protein plays an essential role in coordinating chromosome replication and segregation with cytokinesis. [provided by RefSeq, Oct 2010]
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Cell cycle
Write Your Own Review
You're reviewing:ORC6L (ORC6) (NM_014321) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415362 ORC6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415362 Transient overexpression lysate of origin recognition complex, subunit 6 like (yeast) (ORC6L) 100 ug
$436.00
TP309054 Recombinant protein of human origin recognition complex, subunit 6 like (yeast) (ORC6L), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.