LAP2 (TMPO) (NM_001032283) Human Recombinant Protein

SKU
TP308781
Recombinant protein of human thymopoietin (TMPO), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208781 protein sequence
Red=Cloning site Green=Tags(s)

MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEE
REPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRK
LYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEDSKIELKLEKREPLKGRAKTPV
TLKQRRVEHNQSYSQAGITETEWTSGSSKGGPLQALTRESTRGSRRTPRKRVETSEHFRIDGPVISESTP
IAETIMASSNESLVVNRVTGNFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDILKEMFP
YEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGRSIPVWIKILLF
VVVAVFLFLVYQAMETNQVNPFSNFLHVDPRKSN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 50.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001027454
Locus ID 7112
UniProt ID P42167
Cytogenetics 12q23.1
RefSeq Size 4186
RefSeq ORF 1362
Synonyms CMD1T; LAP2; LEMD4; PRO0868; TP
Summary Through alternative splicing, this gene encodes several distinct LEM domain containing protein isoforms. LEM domain proteins include inner nuclear membrane and intranuclear proteins, and are involved in a variety of cellular functions including gene expression, chromatin organization, and replication and cell cycle control. The encoded alpha isoform is broadly diffuse in the nucleus and contains a lamin binding domain, while the beta and gamma isoforms are localized to the nuclear membrane and contain an HDAC3 interaction domain. The distinct isoforms may compete with each other when acting to chaperone other proteins and regulate transcription. [provided by RefSeq, Aug 2019]
Protein Families Stem cell - Pluripotency, Transmembrane
Write Your Own Review
You're reviewing:LAP2 (TMPO) (NM_001032283) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308781 TMPO MS Standard C13 and N15-labeled recombinant protein (NP_001027454) 10 ug
$3,255.00
LC418798 TMPO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422295 TMPO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422296 TMPO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418798 Transient overexpression lysate of thymopoietin (TMPO), transcript variant 1 100 ug
$665.00
LY422295 Transient overexpression lysate of thymopoietin (TMPO), transcript variant 2 100 ug
$436.00
LY422296 Transient overexpression lysate of thymopoietin (TMPO), transcript variant 3 100 ug
$436.00
TP720158 Recombinant protein of human thymopoietin (TMPO), transcript variant 2 10 ug
$265.00
TP761176 Purified recombinant protein of Human thymopoietin (TMPO), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.