LAP2 (TMPO) (NM_001032283) Human Mass Spec Standard

SKU
PH308781
TMPO MS Standard C13 and N15-labeled recombinant protein (NP_001027454)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208781]
Predicted MW 50.7 kDa
Protein Sequence
Protein Sequence
>RC208781 protein sequence
Red=Cloning site Green=Tags(s)

MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEE
REPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRK
LYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEDSKIELKLEKREPLKGRAKTPV
TLKQRRVEHNQSYSQAGITETEWTSGSSKGGPLQALTRESTRGSRRTPRKRVETSEHFRIDGPVISESTP
IAETIMASSNESLVVNRVTGNFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDILKEMFP
YEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGRSIPVWIKILLF
VVVAVFLFLVYQAMETNQVNPFSNFLHVDPRKSN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001027454
RefSeq Size 4186
RefSeq ORF 1362
Synonyms CMD1T; LAP2; LEMD4; PRO0868; TP
Locus ID 7112
UniProt ID P42167
Cytogenetics 12q23.1
Summary Through alternative splicing, this gene encodes several distinct LEM domain containing protein isoforms. LEM domain proteins include inner nuclear membrane and intranuclear proteins, and are involved in a variety of cellular functions including gene expression, chromatin organization, and replication and cell cycle control. The encoded alpha isoform is broadly diffuse in the nucleus and contains a lamin binding domain, while the beta and gamma isoforms are localized to the nuclear membrane and contain an HDAC3 interaction domain. The distinct isoforms may compete with each other when acting to chaperone other proteins and regulate transcription. [provided by RefSeq, Aug 2019]
Protein Families Stem cell - Pluripotency, Transmembrane
Write Your Own Review
You're reviewing:LAP2 (TMPO) (NM_001032283) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418798 TMPO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422295 TMPO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422296 TMPO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418798 Transient overexpression lysate of thymopoietin (TMPO), transcript variant 1 100 ug
$665.00
LY422295 Transient overexpression lysate of thymopoietin (TMPO), transcript variant 2 100 ug
$436.00
LY422296 Transient overexpression lysate of thymopoietin (TMPO), transcript variant 3 100 ug
$436.00
TP308781 Recombinant protein of human thymopoietin (TMPO), transcript variant 2, 20 µg 20 ug
$737.00
TP720158 Recombinant protein of human thymopoietin (TMPO), transcript variant 2 10 ug
$265.00
TP761176 Purified recombinant protein of Human thymopoietin (TMPO), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.