BAG5 (NM_004873) Human Recombinant Protein

  • Product Brand Image
SKU
TP308518
Recombinant protein of human BCL2-associated athanogene 5 (BAG5), transcript variant 2, 20 µg
  $867.00
In Stock*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208518 protein sequence
Red=Cloning site Green=Tags(s)

MDMGNQHPSISRLQEIQKEVKSVEQQVIGFSGLSDDKNYKKLERILTKQLFEIDSVDTEGKGDIQQARKR
AAQETERLLKELEQNANHPHRIEIQNIFEEAQSLVREKIVPFYNGGNCVTDEFEEGIQDIILRLTHVKTG
GKISLRKARYHTLTKIWAVQEIIEDCMKKQPSLPLSEDAHPSVAKINFVMCEVNKARGVLIALLMGVNNN
ETCRHLSCVLSGLIADLDALDVCGRTEIRNYRREVVEDINKLLKYLDLEEEADTTKAFDLRQNHSILKIE
KVLKRMREIKNELLQAQNPSELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKE
ALEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKC
KAARKQAVRLAQNILSYLDLKSDEWEY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 51 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004864
Locus ID 9529
UniProt ID Q9UL15
Cytogenetics 14q32.33
RefSeq Size 4886
RefSeq ORF 1341
Synonyms BAG-5
Summary The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. Three transcript variants encoding two different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Categories Growth Factors, Intracellular Proteins
Protein Families Druggable Genome
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "BAG5" proteins (7)
SKU Description Size Price
PH308518 BAG5 MS Standard C13 and N15-labeled recombinant protein (NP_004864) 10 ug
$3,360.00
PH312765 BAG5 MS Standard C13 and N15-labeled recombinant protein (NP_001015048) 10 ug
$3,360.00
LC417691 BAG5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423114 BAG5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417691 Transient overexpression lysate of BCL2-associated athanogene 5 (BAG5), transcript variant 2 100 ug
$436.00
LY423114 Transient overexpression lysate of BCL2-associated athanogene 5 (BAG5), transcript variant 3 100 ug
$665.00
TP312765 Recombinant protein of human BCL2-associated athanogene 5 (BAG5), transcript variant 3, 20 µg 20 ug
$867.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.