BAG5 (NM_004873) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC208518] |
Predicted MW | 51.3 kDa |
Protein Sequence |
Protein Sequence
>RC208518 protein sequence
Red=Cloning site Green=Tags(s) MDMGNQHPSISRLQEIQKEVKSVEQQVIGFSGLSDDKNYKKLERILTKQLFEIDSVDTEGKGDIQQARKR AAQETERLLKELEQNANHPHRIEIQNIFEEAQSLVREKIVPFYNGGNCVTDEFEEGIQDIILRLTHVKTG GKISLRKARYHTLTKIWAVQEIIEDCMKKQPSLPLSEDAHPSVAKINFVMCEVNKARGVLIALLMGVNNN ETCRHLSCVLSGLIADLDALDVCGRTEIRNYRREVVEDINKLLKYLDLEEEADTTKAFDLRQNHSILKIE KVLKRMREIKNELLQAQNPSELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKE ALEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKC KAARKQAVRLAQNILSYLDLKSDEWEY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_004864 |
RefSeq Size | 4886 |
RefSeq ORF | 1341 |
Synonyms | BAG-5 |
Locus ID | 9529 |
UniProt ID | Q9UL15 |
Cytogenetics | 14q32.33 |
Summary | The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH312765 | BAG5 MS Standard C13 and N15-labeled recombinant protein (NP_001015048) | 10 ug |
$3,255.00
|
|
LC417691 | BAG5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423114 | BAG5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY417691 | Transient overexpression lysate of BCL2-associated athanogene 5 (BAG5), transcript variant 2 | 100 ug |
$436.00
|
|
LY423114 | Transient overexpression lysate of BCL2-associated athanogene 5 (BAG5), transcript variant 3 | 100 ug |
$665.00
|
|
TP308518 | Recombinant protein of human BCL2-associated athanogene 5 (BAG5), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP312765 | Recombinant protein of human BCL2-associated athanogene 5 (BAG5), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.