BAG5 (NM_004873) Human Mass Spec Standard

SKU
PH308518
BAG5 MS Standard C13 and N15-labeled recombinant protein (NP_004864)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208518]
Predicted MW 51.3 kDa
Protein Sequence
Protein Sequence
>RC208518 protein sequence
Red=Cloning site Green=Tags(s)

MDMGNQHPSISRLQEIQKEVKSVEQQVIGFSGLSDDKNYKKLERILTKQLFEIDSVDTEGKGDIQQARKR
AAQETERLLKELEQNANHPHRIEIQNIFEEAQSLVREKIVPFYNGGNCVTDEFEEGIQDIILRLTHVKTG
GKISLRKARYHTLTKIWAVQEIIEDCMKKQPSLPLSEDAHPSVAKINFVMCEVNKARGVLIALLMGVNNN
ETCRHLSCVLSGLIADLDALDVCGRTEIRNYRREVVEDINKLLKYLDLEEEADTTKAFDLRQNHSILKIE
KVLKRMREIKNELLQAQNPSELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKE
ALEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKC
KAARKQAVRLAQNILSYLDLKSDEWEY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004864
RefSeq Size 4886
RefSeq ORF 1341
Synonyms BAG-5
Locus ID 9529
UniProt ID Q9UL15
Cytogenetics 14q32.33
Summary The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:BAG5 (NM_004873) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH312765 BAG5 MS Standard C13 and N15-labeled recombinant protein (NP_001015048) 10 ug
$3,255.00
LC417691 BAG5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423114 BAG5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417691 Transient overexpression lysate of BCL2-associated athanogene 5 (BAG5), transcript variant 2 100 ug
$436.00
LY423114 Transient overexpression lysate of BCL2-associated athanogene 5 (BAG5), transcript variant 3 100 ug
$665.00
TP308518 Recombinant protein of human BCL2-associated athanogene 5 (BAG5), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312765 Recombinant protein of human BCL2-associated athanogene 5 (BAG5), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.