LRRC48 (DRC3) (NM_031294) Human Recombinant Protein

SKU
TP308501
Recombinant protein of human leucine rich repeat containing 48 (LRRC48), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208501 protein sequence
Red=Cloning site Green=Tags(s)

MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKL
QLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGN
NRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICAYLPDLMYLDYWRIDDHTKKLAEAKHQYSID
ELKHQENLMQAQLEDEQAQREELEKHKTAFVEHLNGSFLFDSMYAEDSEGNNLSYLPGVGELLETYKDKF
VIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSSLSAIREELELPNIEKM
ILECSADISELFDALMTLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEIS
ISTLEKIVEGDLDEDLPNDLRALFVDKDTIVNAVGASHDIHLLKIDNREDELVTRINSWCTRLIDRIHKD
EIMRNRKRVKEINQYIDHMQSELDNLECGDILD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 60.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_112584
Locus ID 83450
UniProt ID Q9H069
Cytogenetics 17p11.2
RefSeq Size 2094
RefSeq ORF 1569
Synonyms CFAP134; LRRC48
Summary Component of the nexin-dynein regulatory complex (N-DRC) a key regulator of ciliary/flagellar motility which maintains the alignment and integrity of the distal axoneme and regulates microtubule sliding in motile axonemes.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:LRRC48 (DRC3) (NM_031294) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308501 LRRC48 MS Standard C13 and N15-labeled recombinant protein (NP_112584) 10 ug
$3,255.00
LC410568 LRRC48 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427158 LRRC48 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410568 Transient overexpression lysate of leucine rich repeat containing 48 (LRRC48), transcript variant 2 100 ug
$436.00
LY427158 Transient overexpression lysate of leucine rich repeat containing 48 (LRRC48), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.