LRRC48 (DRC3) (NM_031294) Human Mass Spec Standard

SKU
PH308501
LRRC48 MS Standard C13 and N15-labeled recombinant protein (NP_112584)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208501]
Predicted MW 61.1 kDa
Protein Sequence
Protein Sequence
>RC208501 protein sequence
Red=Cloning site Green=Tags(s)

MNQPCNSMEPRVMDDDMLKLAVGDQGPQEEAGQLAKQEGILFKDVLSLQLDFRNILRIDNLWQFENLRKL
QLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGN
NRIDNMMNIIYLRRFKCLRTLSLSRNPISEAEDYKMFICAYLPDLMYLDYWRIDDHTKKLAEAKHQYSID
ELKHQENLMQAQLEDEQAQREELEKHKTAFVEHLNGSFLFDSMYAEDSEGNNLSYLPGVGELLETYKDKF
VIICVNIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSSLSAIREELELPNIEKM
ILECSADISELFDALMTLEMQLVEQLEETINMFERNIVDMVGLFIENVQSLMAQCRDLENHHHEKLLEIS
ISTLEKIVEGDLDEDLPNDLRALFVDKDTIVNAVGASHDIHLLKIDNREDELVTRINSWCTRLIDRIHKD
EIMRNRKRVKEINQYIDHMQSELDNLECGDILD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112584
RefSeq Size 2094
RefSeq ORF 1569
Synonyms CFAP134; LRRC48
Locus ID 83450
UniProt ID Q9H069
Cytogenetics 17p11.2
Summary Component of the nexin-dynein regulatory complex (N-DRC) a key regulator of ciliary/flagellar motility which maintains the alignment and integrity of the distal axoneme and regulates microtubule sliding in motile axonemes.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:LRRC48 (DRC3) (NM_031294) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410568 LRRC48 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427158 LRRC48 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410568 Transient overexpression lysate of leucine rich repeat containing 48 (LRRC48), transcript variant 2 100 ug
$436.00
LY427158 Transient overexpression lysate of leucine rich repeat containing 48 (LRRC48), transcript variant 1 100 ug
$436.00
TP308501 Recombinant protein of human leucine rich repeat containing 48 (LRRC48), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.