PLEKHA3 (NM_019091) Human Recombinant Protein

SKU
TP308433
Recombinant protein of human pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3 (PLEKHA3), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208433 protein sequence
Red=Cloning site Green=Tags(s)

MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQH
FYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHH
DENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSV
SHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEE
SRLMAKKQSESEDTLPSFSS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_061964
Locus ID 65977
UniProt ID Q9HB20
Cytogenetics 2q31.2
RefSeq Size 2516
RefSeq ORF 900
Synonyms FAPP1
Summary Involved in Golgi to cell surface membrane traffic. Induces membrane tubulation. Binds preferentially to phosphatidylinositol 4-phosphate (PtdIns4P).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PLEKHA3 (NM_019091) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308433 PLEKHA3 MS Standard C13 and N15-labeled recombinant protein (NP_061964) 10 ug
$3,255.00
LC402733 PLEKHA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402733 Transient overexpression lysate of pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3 (PLEKHA3) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.