PLEKHA3 (NM_019091) Human Mass Spec Standard

SKU
PH308433
PLEKHA3 MS Standard C13 and N15-labeled recombinant protein (NP_061964)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208433]
Predicted MW 33.9 kDa
Protein Sequence
Protein Sequence
>RC208433 protein sequence
Red=Cloning site Green=Tags(s)

MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQH
FYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHH
DENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSV
SHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEE
SRLMAKKQSESEDTLPSFSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061964
RefSeq Size 2516
RefSeq ORF 900
Synonyms FAPP1
Locus ID 65977
UniProt ID Q9HB20
Cytogenetics 2q31.2
Summary Involved in Golgi to cell surface membrane traffic. Induces membrane tubulation. Binds preferentially to phosphatidylinositol 4-phosphate (PtdIns4P).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PLEKHA3 (NM_019091) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402733 PLEKHA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402733 Transient overexpression lysate of pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3 (PLEKHA3) 100 ug
$436.00
TP308433 Recombinant protein of human pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3 (PLEKHA3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.