Staufen (STAU1) (NM_017453) Human Recombinant Protein

SKU
TP308387
Recombinant protein of human staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
5 Days*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208387 representing NM_017453
Red=Cloning site Green=Tags(s)

MSQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPIQNSALPSASITSTSAAAES
ITPTVELNALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNG
KGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEENLNKSEISQVFEIALKRNLPVNFEVARESGP
PHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPE
YGQGINPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLE
ILGFKVPQAQPTKPALKSEEKTPIKKPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPM
VPEVAQAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPS
EQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQS
TEMPRTGNGPMSVCGRC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 63 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_059347
Locus ID 6780
UniProt ID O95793
Cytogenetics 20q13.13
RefSeq Size 3688
RefSeq ORF 1731
Synonyms PPP1R150; STAU
Summary Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. [provided by RefSeq, Apr 2020]
Write Your Own Review
You're reviewing:Staufen (STAU1) (NM_017453) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308387 STAU1 MS Standard C13 and N15-labeled recombinant protein (NP_059347) 10 ug
$3,255.00
LC413756 STAU1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413757 STAU1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413758 STAU1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417883 STAU1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421948 STAU1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413756 Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T2 100 ug
$665.00
LY413757 Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T3 100 ug
$436.00
LY413758 Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T1 100 ug
$665.00
LY417883 Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T4 100 ug
$436.00
LY421948 Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T5 100 ug
$665.00
TP760787 Purified recombinant protein of Human staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00
TP761139 Purified recombinant protein of Human staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T4, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.