Staufen (STAU1) (NM_017453) Human Mass Spec Standard

SKU
PH308387
STAU1 MS Standard C13 and N15-labeled recombinant protein (NP_059347)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208387]
Predicted MW 63 kDa
Protein Sequence
Protein Sequence
>RC208387 representing NM_017453
Red=Cloning site Green=Tags(s)

MSQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPIQNSALPSASITSTSAAAES
ITPTVELNALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNG
KGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEENLNKSEISQVFEIALKRNLPVNFEVARESGP
PHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPE
YGQGINPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLE
ILGFKVPQAQPTKPALKSEEKTPIKKPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPM
VPEVAQAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPS
EQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQS
TEMPRTGNGPMSVCGRC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_059347
RefSeq Size 3688
RefSeq ORF 1731
Synonyms PPP1R150; STAU
Locus ID 6780
UniProt ID O95793
Cytogenetics 20q13.13
Summary Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. [provided by RefSeq, Apr 2020]
Write Your Own Review
You're reviewing:Staufen (STAU1) (NM_017453) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413756 STAU1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413757 STAU1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413758 STAU1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417883 STAU1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421948 STAU1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413756 Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T2 100 ug
$665.00
LY413757 Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T3 100 ug
$436.00
LY413758 Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T1 100 ug
$665.00
LY417883 Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T4 100 ug
$436.00
LY421948 Transient overexpression lysate of staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T5 100 ug
$665.00
TP308387 Recombinant protein of human staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760787 Purified recombinant protein of Human staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00
TP761139 Purified recombinant protein of Human staufen, RNA binding protein, homolog 1 (Drosophila) (STAU1), transcript variant T4, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.