Cathepsin Z (CTSZ) (NM_001336) Human Recombinant Protein
SKU
TP308341
Recombinant protein of human cathepsin Z (CTSZ), 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC208341 protein sequence
Red=Cloning site Green=Tags(s) MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRN VDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSV WDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANG PISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTY KDGKGARYNLAIEEHCTFGDPIV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001327 |
Locus ID | 1522 |
UniProt ID | Q9UBR2 |
Cytogenetics | 20q13.32 |
RefSeq Size | 1517 |
RefSeq ORF | 909 |
Synonyms | CTSX |
Summary | The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Lysosome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH308341 | CTSZ MS Standard C13 and N15-labeled recombinant protein (NP_001327) | 10 ug |
$3,255.00
|
|
LC400531 | CTSZ HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400531 | Transient overexpression lysate of cathepsin Z (CTSZ) | 100 ug |
$436.00
|
|
TP720370 | Recombinant protein of human cathepsin Z (CTSZ) | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.