Cathepsin Z (CTSZ) (NM_001336) Human Mass Spec Standard

SKU
PH308341
CTSZ MS Standard C13 and N15-labeled recombinant protein (NP_001327)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208341]
Predicted MW 33.9 kDa
Protein Sequence
Protein Sequence
>RC208341 protein sequence
Red=Cloning site Green=Tags(s)

MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRN
VDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSV
WDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANG
PISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTY
KDGKGARYNLAIEEHCTFGDPIV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001327
RefSeq Size 1517
RefSeq ORF 909
Synonyms CTSX
Locus ID 1522
UniProt ID Q9UBR2
Cytogenetics 20q13.32
Summary The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. [provided by RefSeq, Oct 2008]
Protein Families Druggable Genome, Protease
Protein Pathways Lysosome
Write Your Own Review
You're reviewing:Cathepsin Z (CTSZ) (NM_001336) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400531 CTSZ HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400531 Transient overexpression lysate of cathepsin Z (CTSZ) 100 ug
$436.00
TP308341 Recombinant protein of human cathepsin Z (CTSZ), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720370 Recombinant protein of human cathepsin Z (CTSZ) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.