RNF156 (MGRN1) (NM_015246) Human Recombinant Protein

SKU
TP308284
Recombinant protein of human mahogunin, ring finger 1 (MGRN1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208284 protein sequence
Red=Cloning site Green=Tags(s)

MGSILSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDLNFLGSRPVQF
PYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDADSPTEDGDKPRVLYSLEFTFDADARVAITIYCQASE
EFLNGRAVYSPKSPSLQSETVHYKRGVSQQFSLPSFKIDFSEWKDDELNFDLDRGVFPVVIQAVVDEGDV
VEVTGHAHVLLAAFEKHMDGSFSVKPLKQKQIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVV
CLSDLRDTLILPCRHLCLCTSCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPVSFSPVLAQSLE
HDEHSCPFKKSKPHPASLASKKPKRETNSDSVPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGIS
DGLSQASCPLAAIDHILDSSRQKGRPQSKAPDSTLRSPSSPIHEEDEEKLSEDVDAPPPLGGAELALRES
SSPESFITEEVDESSSPQQGTRAASIENVLQDSSPEHCGRGPPADIYLPGRPTSMETAHGLATTSPTWPP
LGGPSPDPSAAELTPL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 63 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056061
Locus ID 23295
UniProt ID O60291
Cytogenetics 16p13.3
RefSeq Size 3934
RefSeq ORF 1728
Synonyms RNF156
Summary Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.[supplied by OMIM, Apr 2004]
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:RNF156 (MGRN1) (NM_015246) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308284 MGRN1 MS Standard C13 and N15-labeled recombinant protein (NP_056061) 10 ug
$3,255.00
LC414714 MGRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428013 MGRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428014 MGRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414714 Transient overexpression lysate of mahogunin, ring finger 1 (MGRN1), transcript variant 1 100 ug
$436.00
LY428013 Transient overexpression lysate of mahogunin, ring finger 1 (MGRN1), transcript variant 3 100 ug
$436.00
LY428014 Transient overexpression lysate of mahogunin, ring finger 1 (MGRN1), transcript variant 4 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.