RNF156 (MGRN1) (NM_015246) Human Mass Spec Standard

SKU
PH308284
MGRN1 MS Standard C13 and N15-labeled recombinant protein (NP_056061)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208284]
Predicted MW 63.2 kDa
Protein Sequence
Protein Sequence
>RC208284 protein sequence
Red=Cloning site Green=Tags(s)

MGSILSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDLNFLGSRPVQF
PYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDADSPTEDGDKPRVLYSLEFTFDADARVAITIYCQASE
EFLNGRAVYSPKSPSLQSETVHYKRGVSQQFSLPSFKIDFSEWKDDELNFDLDRGVFPVVIQAVVDEGDV
VEVTGHAHVLLAAFEKHMDGSFSVKPLKQKQIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVV
CLSDLRDTLILPCRHLCLCTSCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPVSFSPVLAQSLE
HDEHSCPFKKSKPHPASLASKKPKRETNSDSVPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGIS
DGLSQASCPLAAIDHILDSSRQKGRPQSKAPDSTLRSPSSPIHEEDEEKLSEDVDAPPPLGGAELALRES
SSPESFITEEVDESSSPQQGTRAASIENVLQDSSPEHCGRGPPADIYLPGRPTSMETAHGLATTSPTWPP
LGGPSPDPSAAELTPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056061
RefSeq Size 3934
RefSeq ORF 1728
Synonyms RNF156
Locus ID 23295
UniProt ID O60291
Cytogenetics 16p13.3
Summary Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.[supplied by OMIM, Apr 2004]
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:RNF156 (MGRN1) (NM_015246) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414714 MGRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428013 MGRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428014 MGRN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414714 Transient overexpression lysate of mahogunin, ring finger 1 (MGRN1), transcript variant 1 100 ug
$436.00
LY428013 Transient overexpression lysate of mahogunin, ring finger 1 (MGRN1), transcript variant 3 100 ug
$436.00
LY428014 Transient overexpression lysate of mahogunin, ring finger 1 (MGRN1), transcript variant 4 100 ug
$436.00
TP308284 Recombinant protein of human mahogunin, ring finger 1 (MGRN1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.