VPS4A (NM_013245) Human Recombinant Protein

SKU
TP308099
Recombinant protein of human vacuolar protein sorting 4 homolog A (S. cerevisiae) (VPS4A), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208099 protein sequence
Red=Cloning site Green=Tags(s)

MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKL
KDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALK
EAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVK
NLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSA
IRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQ
SATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNA
DDLLKVKKFSEDFGQES

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 48.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_037377
Locus ID 27183
UniProt ID Q9UN37
Cytogenetics 16q22.1
RefSeq Size 2211
RefSeq ORF 1311
Synonyms CIMDAG; SKD1; SKD1A; SKD2; VPS4; VPS4-1
Summary The protein encoded by this gene is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. The former share a high degree of aa sequence similarity with each other, and also with yeast Vps4 and mouse Skd1 proteins. The mouse Skd1 (suppressor of K+ transport defect 1) has been shown to be really an yeast Vps4 ortholog. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast. The gene encoding this paralog has been mapped to chromosome 16; the gene for the other resides on chromosome 18. [provided by RefSeq, Jul 2008]
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:VPS4A (NM_013245) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308099 VPS4A MS Standard C13 and N15-labeled recombinant protein (NP_037377) 10 ug
$3,255.00
LC415707 VPS4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415707 Transient overexpression lysate of vacuolar protein sorting 4 homolog A (S. cerevisiae) (VPS4A) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.