TCP11L1 (NM_018393) Human Recombinant Protein

SKU
TP308041
Recombinant protein of human t-complex 11 (mouse)-like 1 (TCP11L1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208041 protein sequence
Red=Cloning site Green=Tags(s)

MSENLDKSNVNEAGKSKSNDSEEGLEDAVEGADEALQKAIKSDSSSPQRVQRPHSSPPRFVTVEELLETA
RGVTNMALAHEIVVNGDFQIKPVELPENSLKKRVKEIVHKAFWDCLSVQLSEDPPAYDHAIKLVGEIKET
LLSFLLPGHTRLRNQITEVLDLDLIKQEAENGALDISRLAEFIIGMMGTLCAPARDEEVKKLKDIKEIVP
LFREIFSVLDLMKVDMANFAISSIRPHLMQQSVEYERKKFQEILERQPNSLDFVTQWLEEASEDLMTQKY
KHALPVGGMAAGSGDMPRLSPVAVQNYAYLKLLKWDHLQRPFPETVLMDQSRFHELQLQLEQLTILGAVL
LVTFSMAAPGISSQADFAEKLKMIVKILLTDMHLPSFHLKDVLTTIGEKVCLEVSSCLSLCGSSPFTTDK
ETVLKGQIQAVASPDDPIRRIMESRILTFLETYLASGHQKPLPTVPGGLSPVQRELEEVAIKFARLVNYN
KMVFCPYYDAILSKILVRS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 56.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060863
Locus ID 55346
UniProt ID Q9NUJ3
Cytogenetics 11p13
RefSeq Size 2817
RefSeq ORF 1527
Synonyms dJ85M6.3
Write Your Own Review
You're reviewing:TCP11L1 (NM_018393) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308041 TCP11L1 MS Standard C13 and N15-labeled recombinant protein (NP_060863) 10 ug
$3,255.00
PH328003 TCP11L1 MS Standard C13 and N15-labeled recombinant protein (NP_001139013) 10 ug
$3,255.00
LC413091 TCP11L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428932 TCP11L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413091 Transient overexpression lysate of t-complex 11 (mouse)-like 1 (TCP11L1), transcript variant 1 100 ug
$436.00
LY428932 Transient overexpression lysate of t-complex 11 (mouse)-like 1 (TCP11L1), transcript variant 2 100 ug
$436.00
TP328003 Recombinant protein of human t-complex 11 (mouse)-like 1 (TCP11L1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.