TCP11L1 (NM_001145541) Human Mass Spec Standard

SKU
PH328003
TCP11L1 MS Standard C13 and N15-labeled recombinant protein (NP_001139013)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC228003]
Predicted MW 57.1 kDa
Protein Sequence
Protein Sequence
>RC228003 protein sequence
Red=Cloning site Green=Tags(s)

MSENLDKSNVNEAGKSKSNDSEEGLEDAVEGADEALQKAIKSDSSSPQRVQRPHSSPPRFVTVEELLETA
RGVTNMALAHEIVVNGDFQIKPVELPENSLKKRVKEIVHKAFWDCLSVQLSEDPPAYDHAIKLVGEIKET
LLSFLLPGHTRLRNQITEVLDLDLIKQEAENGALDISRLAEFIIGMMGTLCAPARDEEVKKLKDIKEIVP
LFREIFSVLDLMKVDMANFAISSIRPHLMQQSVEYERKKFQEILERQPNSLDFVTQWLEEASEDLMTQKY
KHALPVGGMAAGSGDMPRLSPVAVQNYAYLKLLKWDHLQRPFPETVLMDQSRFHELQLQLEQLTILGAVL
LVTFSMAAPGISSQADFAEKLKMIVKILLTDMHLPSFHLKDVLTTIGEKVCLEVSSCLSLCGSSPFTTDK
ETVLKGQIQAVASPDDPIRRIMESRILTFLETYLASGHQKPLPTVPGGLSPVQRELEEVAIKFARLVNYN
KMVFCPYYDAILSKILVRS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001139013
RefSeq Size 2633
RefSeq ORF 1527
Synonyms dJ85M6.3
Locus ID 55346
UniProt ID Q9NUJ3
Cytogenetics 11p13
Write Your Own Review
You're reviewing:TCP11L1 (NM_001145541) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH308041 TCP11L1 MS Standard C13 and N15-labeled recombinant protein (NP_060863) 10 ug
$3,255.00
LC413091 TCP11L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428932 TCP11L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413091 Transient overexpression lysate of t-complex 11 (mouse)-like 1 (TCP11L1), transcript variant 1 100 ug
$436.00
LY428932 Transient overexpression lysate of t-complex 11 (mouse)-like 1 (TCP11L1), transcript variant 2 100 ug
$436.00
TP308041 Recombinant protein of human t-complex 11 (mouse)-like 1 (TCP11L1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP328003 Recombinant protein of human t-complex 11 (mouse)-like 1 (TCP11L1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.