GRHL3 (NM_198174) Human Recombinant Protein

SKU
TP307857
Purified recombinant protein of Homo sapiens grainyhead-like 3 (Drosophila) (GRHL3), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207857 protein sequence
Red=Cloning site Green=Tags(s)

MRVNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLESPTHLMKFLTENV
SGTPEYPDLLKKNNLMSLEGALPTPGKAAPLPAGPSKLEAGSVDSYLLPTTDMYDNGSLNSLFESIHGVP
PTQRWQPDSTFKDDPQESMLFPDILKTSPEPPCPEDYPSLKSDFEYTLGSPKAIHIKSGESPMAYLNKGQ
FYPVTLRTPAGGKGLALSSNKVKSVVMVVFDNEKVPVEQLRFWKHWHSRQPTAKQRVIDVADCKENFNTV
EHIEEVAYNALSFVWNVNEEAKVFIGVNCLSTDFSSQKGVKGVPLNLQIDTYDCGLGTERLVHRAVCQIK
IFCDKGAERKMRDDERKQFRRKVKCPDSSNSGVKGCLLSGFRGNETTYLRPETDLETPPVLFIPNVHFSS
LQRSGGAAPSAGPSSSNRLPLKRTCSPFTEEFEPLPSKQAKEGDLQRVLLYVRRETEEVFDALMLKTPDL
KGLRNAISEKYGFPEENIYKVYKKCKRGILVNMDNNIIQHYSNHVAFLLDMGELDGKIQIILKEL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 56.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_937817
Locus ID 57822
UniProt ID Q8TE85
Cytogenetics 1p36.11
RefSeq Size 2232
RefSeq ORF 1665
Synonyms SOM; TFCP2L4; VWS2
Summary This gene encodes a member of the grainyhead family of transcription factors. The encoded protein may function as a transcription factor during development, and has been shown to stimulate migration of endothelial cells. Multiple transcript variants encoding distinct isoforms have been identified for this gene.[provided by RefSeq, Aug 2010]
Write Your Own Review
You're reviewing:GRHL3 (NM_198174) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH307857 GRHL3 MS Standard C13 and N15-labeled recombinant protein (NP_937817) 10 ug
$3,255.00
LC404981 GRHL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC412043 GRHL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404981 Transient overexpression lysate of grainyhead-like 3 (Drosophila) (GRHL3), transcript variant 3 100 ug
$436.00
LY412043 Transient overexpression lysate of grainyhead-like 3 (Drosophila) (GRHL3), transcript variant 1 100 ug
$665.00
TP760712 Purified recombinant protein of Human grainyhead-like 3 (Drosophila) (GRHL3), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.