GRHL3 (NM_198174) Human Mass Spec Standard

SKU
PH307857
GRHL3 MS Standard C13 and N15-labeled recombinant protein (NP_937817)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207857]
Predicted MW 62.2 kDa
Protein Sequence
Protein Sequence
>RC207857 protein sequence
Red=Cloning site Green=Tags(s)

MRVNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLESPTHLMKFLTENV
SGTPEYPDLLKKNNLMSLEGALPTPGKAAPLPAGPSKLEAGSVDSYLLPTTDMYDNGSLNSLFESIHGVP
PTQRWQPDSTFKDDPQESMLFPDILKTSPEPPCPEDYPSLKSDFEYTLGSPKAIHIKSGESPMAYLNKGQ
FYPVTLRTPAGGKGLALSSNKVKSVVMVVFDNEKVPVEQLRFWKHWHSRQPTAKQRVIDVADCKENFNTV
EHIEEVAYNALSFVWNVNEEAKVFIGVNCLSTDFSSQKGVKGVPLNLQIDTYDCGLGTERLVHRAVCQIK
IFCDKGAERKMRDDERKQFRRKVKCPDSSNSGVKGCLLSGFRGNETTYLRPETDLETPPVLFIPNVHFSS
LQRSGGAAPSAGPSSSNRLPLKRTCSPFTEEFEPLPSKQAKEGDLQRVLLYVRRETEEVFDALMLKTPDL
KGLRNAISEKYGFPEENIYKVYKKCKRGILVNMDNNIIQHYSNHVAFLLDMGELDGKIQIILKEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_937817
RefSeq Size 2232
RefSeq ORF 1665
Synonyms SOM; TFCP2L4; VWS2
Locus ID 57822
UniProt ID Q8TE85
Cytogenetics 1p36.11
Summary This gene encodes a member of the grainyhead family of transcription factors. The encoded protein may function as a transcription factor during development, and has been shown to stimulate migration of endothelial cells. Multiple transcript variants encoding distinct isoforms have been identified for this gene.[provided by RefSeq, Aug 2010]
Write Your Own Review
You're reviewing:GRHL3 (NM_198174) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404981 GRHL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC412043 GRHL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404981 Transient overexpression lysate of grainyhead-like 3 (Drosophila) (GRHL3), transcript variant 3 100 ug
$436.00
LY412043 Transient overexpression lysate of grainyhead-like 3 (Drosophila) (GRHL3), transcript variant 1 100 ug
$665.00
TP307857 Purified recombinant protein of Homo sapiens grainyhead-like 3 (Drosophila) (GRHL3), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP760712 Purified recombinant protein of Human grainyhead-like 3 (Drosophila) (GRHL3), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.