FAM119A (METTL21A) (NM_145280) Human Recombinant Protein
SKU
TP307629
Recombinant protein of human family with sequence similarity 119, member A (FAM119A), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC207629 protein sequence
Red=Cloning site Green=Tags(s) MALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAV ELGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLI LGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQ KRNQKEDL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_660323 |
Locus ID | 151194 |
UniProt ID | Q8WXB1 |
Cytogenetics | 2q33.3 |
RefSeq Size | 4748 |
RefSeq ORF | 654 |
Synonyms | FAM119A; HCA557b; HSPA-KMT |
Summary | Protein-lysine methyltransferase that selectively trimethylates residues in heat shock protein 70 (HSP70) family members. Contributes to the in vivo trimethylation of Lys residues in HSPA1 and HSPA8. In vitro methylates 'Lys-561' in HSPA1, 'Lys-564' in HSPA2, 'Lys-585' in HSPA5, 'Lys-563' in HSPA6 and 'Lys-561' in HSPA8.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH307629 | FAM119A MS Standard C13 and N15-labeled recombinant protein (NP_660323) | 10 ug |
$3,255.00
|
|
LC408004 | METTL21A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426777 | METTL21A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY408004 | Transient overexpression lysate of family with sequence similarity 119, member A (FAM119A), transcript variant 1 | 100 ug |
$436.00
|
|
LY426777 | Transient overexpression lysate of family with sequence similarity 119, member A (FAM119A), transcript variant 2 | 100 ug |
$436.00
|
|
TP760710 | Purified recombinant protein of Human methyltransferase like 21A (METTL21A), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.