FAM119A (METTL21A) (NM_145280) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC207629] |
Predicted MW | 24.6 kDa |
Protein Sequence |
Protein Sequence
>RC207629 protein sequence
Red=Cloning site Green=Tags(s) MALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAV ELGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLI LGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQ KRNQKEDL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_660323 |
RefSeq Size | 4748 |
RefSeq ORF | 654 |
Synonyms | FAM119A; HCA557b; HSPA-KMT |
Locus ID | 151194 |
UniProt ID | Q8WXB1 |
Cytogenetics | 2q33.3 |
Summary | Protein-lysine methyltransferase that selectively trimethylates residues in heat shock protein 70 (HSP70) family members. Contributes to the in vivo trimethylation of Lys residues in HSPA1 and HSPA8. In vitro methylates 'Lys-561' in HSPA1, 'Lys-564' in HSPA2, 'Lys-585' in HSPA5, 'Lys-563' in HSPA6 and 'Lys-561' in HSPA8.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC408004 | METTL21A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426777 | METTL21A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY408004 | Transient overexpression lysate of family with sequence similarity 119, member A (FAM119A), transcript variant 1 | 100 ug |
$436.00
|
|
LY426777 | Transient overexpression lysate of family with sequence similarity 119, member A (FAM119A), transcript variant 2 | 100 ug |
$436.00
|
|
TP307629 | Recombinant protein of human family with sequence similarity 119, member A (FAM119A), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP760710 | Purified recombinant protein of Human methyltransferase like 21A (METTL21A), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.