FCER1G (NM_004106) Human Recombinant Protein

SKU
TP307585L
Recombinant protein of human Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide (FCER1G), 1 mg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$7,820.00
6 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>Peptide sequence encoded by RC207585
Blue=ORF Red=Cloning site Green=Tag(s)

MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAITSYEKSDGVYTGL
STRNQETYETLKHEKPPQ

myc-FLAG tag

Recombinant protein using RC207585 also available, TP307585
Tag C-Myc/DDK
Predicted MW 7.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004097
Locus ID 2207
UniProt ID P30273
Cytogenetics 1q23.3
RefSeq Size 591
RefSeq ORF 261
Synonyms FCRG
Summary The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Protein Pathways Asthma, Fc epsilon RI signaling pathway, Natural killer cell mediated cytotoxicity
Write Your Own Review
You're reviewing:FCER1G (NM_004106) Human Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.