FCER1G (NM_004106) Human Recombinant Protein

CAT#: TP307585

Recombinant protein of human Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide (FCER1G), 20 µg

Product Images

Coomassie blue staining of purified FCER1G protein (Cat# TP307585). The protein was produced from HEK293T cells transfected with FCER1G cDNA clone (Cat# RC207585) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >Peptide sequence encoded by RC207585
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAITSYEKSDGVYTGL
  STRNQETYETLKHEKPPQ
  myc-FLAG tag
  
  Recombinant protein using RC207585 also available, TP307585
• Tag: C-Myc/DDK
• Predicted MW: 7.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004097
• Locus ID: 2207
• UniProt ID: P30273
• Cytogenetics: 1q23.3
• Refseq Size: 591
• Refseq ORF: 261
• Synonyms: FCRG
• Summary: The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: Asthma, Fc epsilon RI signaling pathway, Natural killer cell mediated cytotoxicity