FCER1G (NM_004106) Human Tagged ORF Clone

CAT#: RC207585

Reviews ()
Write a review

FCER1G (Myc-DDK-tagged)-Human Fc fragment of IgE, high affinity I, receptor for, gamma polypeptide (FCER1G)



Reconstitution Protocol

USD 150.00

USD 225.00

In Stock*

Size
    • 10 ug

Product images

Other products for "FCER1G"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol FCER1G
Synonyms FCRG
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207585 representing NM_004106.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGATTCCAGCAGTGGTCTTGCTCTTACTCCTTTTGGTTGAACAAGCAGCGGCCCTGGGAGAGCCTCAG
CTCTGCTATATCCTGGATGCCATCCTGTTTCTGTATGGAATTGTCCTCACCCTCCTCTACTGTCGACTG
AAGGTAATCCAAGTGCGAAAGGCAGCTATAACCAGCTATGAGAAATCAGATGGTGTTTACACGGGCCTG
AGCACCAGGAACCAGGAGACTTACGAGACTCTGAAGCATGAGAAACCACCACAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
>Peptide sequence encoded by RC207585
Blue=ORF Red=Cloning site Green=Tag(s)

MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAITSYEKSDGVYTGL
STRNQETYETLKHEKPPQ

myc-FLAG tag

Recombinant protein using RC207585 also available, TP307585
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004106
ORF Size 261 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq Size 591 bp
RefSeq ORF 261 bp
Locus ID 2207
UniProt ID P30273
Cytogenetics 1q23.3
Domains ITAM
Protein Families Transmembrane
Protein Pathways Asthma, Fc epsilon RI signaling pathway, Natural killer cell mediated cytotoxicity
MW 9.8 kDa
Gene Summary The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.