MINPP1 (NM_004897) Human Recombinant Protein
SKU
TP307581
Recombinant protein of human multiple inositol polyphosphate histidine phosphatase, 1 (MINPP1), 20 µg
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC207581 representing NM_004897
Red=Cloning site Green=Tags(s) MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRD PELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYAD WMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPD VADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADL IQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKA VEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLY HCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.9 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_004888 |
Locus ID | 9562 |
UniProt ID | Q9UNW1 |
Cytogenetics | 10q23.2 |
RefSeq Size | 2412 |
RefSeq ORF | 1461 |
Synonyms | HIPER1; MINPP2; MIPP |
Summary | This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway.[provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Inositol phosphate metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH307581 | MINPP1 MS Standard C13 and N15-labeled recombinant protein (NP_004888) | 10 ug |
$3,255.00
|
|
LC417667 | MINPP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC432866 | MINPP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY417667 | Transient overexpression lysate of multiple inositol polyphosphate histidine phosphatase, 1 (MINPP1) | 100 ug |
$436.00
|
|
LY432866 | Transient overexpression lysate of multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 2 | 100 ug |
$436.00
|
|
TP329866 | Purified recombinant protein of Homo sapiens multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
TP710176 | Purified recombinant protein of Human multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug | 20 ug |
$515.00
|
|
TP720678 | Purified recombinant protein of Human multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 1 | 10 ug |
$265.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.