MINPP1 (NM_004897) Human Recombinant Protein

SKU
TP307581
Recombinant protein of human multiple inositol polyphosphate histidine phosphatase, 1 (MINPP1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207581 representing NM_004897
Red=Cloning site Green=Tags(s)

MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRD
PELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYAD
WMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPD
VADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADL
IQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKA
VEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLY
HCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.9 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004888
Locus ID 9562
UniProt ID Q9UNW1
Cytogenetics 10q23.2
RefSeq Size 2412
RefSeq ORF 1461
Synonyms HIPER1; MINPP2; MIPP
Summary This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway.[provided by RefSeq, Sep 2009]
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism
Write Your Own Review
You're reviewing:MINPP1 (NM_004897) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH307581 MINPP1 MS Standard C13 and N15-labeled recombinant protein (NP_004888) 10 ug
$3,255.00
LC417667 MINPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432866 MINPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417667 Transient overexpression lysate of multiple inositol polyphosphate histidine phosphatase, 1 (MINPP1) 100 ug
$436.00
LY432866 Transient overexpression lysate of multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 2 100 ug
$436.00
TP329866 Purified recombinant protein of Homo sapiens multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 2, 20 µg 20 ug
$867.00
TP710176 Purified recombinant protein of Human multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00
TP720678 Purified recombinant protein of Human multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 1 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.