MINPP1 (NM_004897) Human Mass Spec Standard

SKU
PH307581
MINPP1 MS Standard C13 and N15-labeled recombinant protein (NP_004888)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207581]
Predicted MW 54.9 kDa
Protein Sequence
Protein Sequence
>RC207581 representing NM_004897
Red=Cloning site Green=Tags(s)

MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRD
PELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYAD
WMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPD
VADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADL
IQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKA
VEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLY
HCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004888
RefSeq Size 2412
RefSeq ORF 1461
Synonyms HIPER1; MINPP2; MIPP
Locus ID 9562
UniProt ID Q9UNW1
Cytogenetics 10q23.2
Summary This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway.[provided by RefSeq, Sep 2009]
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism
Write Your Own Review
You're reviewing:MINPP1 (NM_004897) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417667 MINPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432866 MINPP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417667 Transient overexpression lysate of multiple inositol polyphosphate histidine phosphatase, 1 (MINPP1) 100 ug
$436.00
LY432866 Transient overexpression lysate of multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 2 100 ug
$436.00
TP307581 Recombinant protein of human multiple inositol polyphosphate histidine phosphatase, 1 (MINPP1), 20 µg 20 ug
$867.00
TP329866 Purified recombinant protein of Homo sapiens multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 2, 20 µg 20 ug
$867.00
TP710176 Purified recombinant protein of Human multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00
TP720678 Purified recombinant protein of Human multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 1 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.